PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00039697-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family GRAS
Protein Properties Length: 766aa    MW: 84288 Da    PI: 5.5505
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00039697-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS390.12.5e-1194017622374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalklfsevsPilk 92 
                        +lLl+cAea+s ++ ++a ++L +lse ++p+g+p+qR+aayf+e++a rl++s  +l+  l+ s+ +       + l+a+++f++++P++k
  PSME_00039697-RA 401 LSLLLQCAEAISLDNIQQAYSILPQLSEFSTPYGNPLQRVAAYFAEGMAVRLHNSYLGLCCPLEISRPQLLAsiNHSILTAFQTFNNICPFVK 493
                       689********************************************************9999888777555456677889999********* PP

              GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakr 185
                       fsh+t NqaIlea++ge++vHiiDfdi+qGlQWpaL++ La+Rp+g p +RiTg+g     s e+le+tg+rL++fA++l++pfef++ va++
  PSME_00039697-RA 494 FSHFTSNQAILEAFNGESQVHIIDFDIMQGLQWPALFHILAARPGGCPYVRITGLGT----SMEALEATGKRLSSFAHTLKLPFEFHP-VAEK 581
                       *********************************************************....***************************.7*** PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                       l +l++ +Lrv++g+alaV++ +  h+l+d ++s +     +L+l+++l+Pkv+++veq++ +  ++Fl+rf+eal+yysa+fd+l a + ++
  PSME_00039697-RA 582 LGKLDPAALRVRNGDALAVHWLH--HSLYDVTGSDTC----TLRLLQRLNPKVITMVEQDLHL-LGPFLNRFIEALHYYSAMFDALGACFNED 667
                       **********************9..999988888887....********************99.889************************** PP

              GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                       + +r++vE++ll+ ei+n++a  g +r+ +++ +++Wr  l+++GF+++++s +a +qa+lll+++  +gy++ ee g l lgWkd +L+++S
  PSME_00039697-RA 668 NMDRHSVEQQLLSHEIRNILAVGGPARTGETK-FQNWRTHLQSCGFRQISMSGNAFAQAELLLNMFCCEGYSLVEEGGILKLGWKDLSLYTAS 759
                       **************************888776.************************************************************ PP

              GRAS 372 aWr 374
                       aWr
  PSME_00039697-RA 760 AWR 762
                       **8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.085374742IPR005202Transcription factor GRAS
PfamPF035148.7E-117401762IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 766 aa     Download sequence    Send to blast
MTTCSDKAPQ RSCQDEYSGS SSGICEGPSY YNLITAGDFN GVTEDDQNQV GLSGADGLKV  60
IASANRRMKN LMQGSSSAQE EASSVLQSPN SWPSSLNTLQ TIFNPCSSPS WEGSQTRLPV  120
PYIATGSADF LIPADPDATS PGMFWGESSG RLLDMQFMNK NGPAERRMDS CVVDPKLDEI  180
LMPRMSHAET LISSSRAISE PFSAPDGVLN YMSSNIRAVQ MVLQDNNQSS NKRSGMVKEA  240
VGFVVASEKT VLDNTVSGYE SLCQGWRHAP TTMMKKREFN ADHEGLISQP DSGQSFLECN  300
LMERQAIMDS SEIDHQGCTQ SVGFQLQSKA KRPCHVSYGE CSSQSDQQGF TTLYQGQIQD  360
SCAAQIKTNT ETNHEASCKK TLNASSNASY ELTDAQGLHL LSLLLQCAEA ISLDNIQQAY  420
SILPQLSEFS TPYGNPLQRV AAYFAEGMAV RLHNSYLGLC CPLEISRPQL LASINHSILT  480
AFQTFNNICP FVKFSHFTSN QAILEAFNGE SQVHIIDFDI MQGLQWPALF HILAARPGGC  540
PYVRITGLGT SMEALEATGK RLSSFAHTLK LPFEFHPVAE KLGKLDPAAL RVRNGDALAV  600
HWLHHSLYDV TGSDTCTLRL LQRLNPKVIT MVEQDLHLLG PFLNRFIEAL HYYSAMFDAL  660
GACFNEDNMD RHSVEQQLLS HEIRNILAVG GPARTGETKF QNWRTHLQSC GFRQISMSGN  720
AFAQAELLLN MFCCEGYSLV EEGGILKLGW KDLSLYTASA WRSWTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-544007624375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM2643901e-170KM264390.1 Pinus radiata SCL3 (SCL3) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0B4U7W60.0A0A0B4U7W6_PINRA; SCR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.11e-162GRAS family protein